Lineage for d4cywf_ (4cyw F:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1969985Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256742] (3 PDB entries)
  8. 1969994Domain d4cywf_: 4cyw F: [257767]
    Other proteins in same PDB: d4cywa_, d4cywc_, d4cywe_
    automated match to d3m5ib_
    complexed with nag

Details for d4cywf_

PDB Entry: 4cyw (more details), 2.6 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin in complex with human receptor analog 6-sln
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4cywf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cywf_ h.3.1.1 (F:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlni

SCOPe Domain Coordinates for d4cywf_:

Click to download the PDB-style file with coordinates for d4cywf_.
(The format of our PDB-style files is described here.)

Timeline for d4cywf_: