Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256742] (3 PDB entries) |
Domain d4cywf_: 4cyw F: [257767] Other proteins in same PDB: d4cywa_, d4cywc_, d4cywe_ automated match to d3m5ib_ complexed with nag |
PDB Entry: 4cyw (more details), 2.6 Å
SCOPe Domain Sequences for d4cywf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cywf_ h.3.1.1 (F:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]} glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlni
Timeline for d4cywf_: