![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily) multihelical |
![]() | Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) ![]() duplication: all chain but the N-terminal helix forms two structural repeats |
![]() | Family a.124.1.0: automated matches [194368] (1 protein) not a true family |
![]() | Protein automated matches [194369] (3 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196872] (5 PDB entries) |
![]() | Domain d4cwma1: 4cwm A:1-263 [257762] Other proteins in same PDB: d4cwma2, d4cwmb2 automated match to d3w52a_ complexed with zn |
PDB Entry: 4cwm (more details), 2.09 Å
SCOPe Domain Sequences for d4cwma1:
Sequence, based on SEQRES records: (download)
>d4cwma1 a.124.1.0 (A:1-263) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} wgkegheiickiaqtrldetaakavkellpesaegdlsslclwadrvkfryhwssplhyi ntpdacsyqynrdckdesgekgrcvagaiynyttqllsyktaassqsqynlteallfvsh fmgdihqplhvsyasdkggntievhwytrkanlhhiwdsniietaeadlynsalegmvda lkknittewadqvkrwetctkktacpdiyasegiqaacdwaykgvtegdtledeyfysrl pivyqrlaqggvrlaatlnrifg
>d4cwma1 a.124.1.0 (A:1-263) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} wgkegheiickiaqtrldetaakavkellpesaegdlsslclwadrvkfryhwssplhyi ntpdacsyqynrdckdesgekgrcvagaiynyttqllsyksqynlteallfvshfmgdih qplhvsyasdkggntievhwytrkanlhhiwdsniietaeadlynsalegmvdalkknit tewadqvkrwetctktacpdiyasegiqaacdwaykgvtegdtledeyfysrlpivyqrl aqggvrlaatlnrifg
Timeline for d4cwma1: