Lineage for d4cwma1 (4cwm A:1-263)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009738Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2009739Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2009774Family a.124.1.0: automated matches [194368] (1 protein)
    not a true family
  6. 2009775Protein automated matches [194369] (3 species)
    not a true protein
  7. 2009781Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196872] (5 PDB entries)
  8. 2009787Domain d4cwma1: 4cwm A:1-263 [257762]
    Other proteins in same PDB: d4cwma2, d4cwmb2
    automated match to d3w52a_
    complexed with zn

Details for d4cwma1

PDB Entry: 4cwm (more details), 2.09 Å

PDB Description: High-glycosylation crystal structure of the bifunctional endonuclease (AtBFN2) from Arabidopsis thaliana
PDB Compounds: (A:) Endonuclease 2

SCOPe Domain Sequences for d4cwma1:

Sequence, based on SEQRES records: (download)

>d4cwma1 a.124.1.0 (A:1-263) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
wgkegheiickiaqtrldetaakavkellpesaegdlsslclwadrvkfryhwssplhyi
ntpdacsyqynrdckdesgekgrcvagaiynyttqllsyktaassqsqynlteallfvsh
fmgdihqplhvsyasdkggntievhwytrkanlhhiwdsniietaeadlynsalegmvda
lkknittewadqvkrwetctkktacpdiyasegiqaacdwaykgvtegdtledeyfysrl
pivyqrlaqggvrlaatlnrifg

Sequence, based on observed residues (ATOM records): (download)

>d4cwma1 a.124.1.0 (A:1-263) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
wgkegheiickiaqtrldetaakavkellpesaegdlsslclwadrvkfryhwssplhyi
ntpdacsyqynrdckdesgekgrcvagaiynyttqllsyksqynlteallfvshfmgdih
qplhvsyasdkggntievhwytrkanlhhiwdsniietaeadlynsalegmvdalkknit
tewadqvkrwetctktacpdiyasegiqaacdwaykgvtegdtledeyfysrlpivyqrl
aqggvrlaatlnrifg

SCOPe Domain Coordinates for d4cwma1:

Click to download the PDB-style file with coordinates for d4cwma1.
(The format of our PDB-style files is described here.)

Timeline for d4cwma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cwma2