Lineage for d4cvia_ (4cvi A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002776Protein automated matches [190089] (8 species)
    not a true protein
  7. 2002777Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (24 PDB entries)
  8. 2002800Domain d4cvia_: 4cvi A: [257761]
    automated match to d2xj5a_
    complexed with dod, hem

Details for d4cvia_

PDB Entry: 4cvi (more details), 2.41 Å

PDB Description: neutron structure of ferric cytochrome c peroxidase - deuterium exchanged at room temperature
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d4cvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cvia_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
plvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthl
knsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
kylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d4cvia_:

Click to download the PDB-style file with coordinates for d4cvia_.
(The format of our PDB-style files is described here.)

Timeline for d4cvia_: