Lineage for d4cuoa_ (4cuo A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2328588Protein automated matches [190089] (8 species)
    not a true protein
  7. 2328627Species Ficus benghalensis [TaxId:309271] [257753] (1 PDB entry)
  8. 2328628Domain d4cuoa_: 4cuo A: [257754]
    automated match to d4atja_
    complexed with ca, cl, co3, hem, na, nag, so4

Details for d4cuoa_

PDB Entry: 4cuo (more details), 1.67 Å

PDB Description: Banyan peroxidase with glycosylation
PDB Compounds: (A:) banyan peroxidase

SCOPe Domain Sequences for d4cuoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cuoa_ a.93.1.1 (A:) automated matches {Ficus benghalensis [TaxId: 309271]}
qltptfyrstcpnvtsivrgviqdalqtdlripaslirlhfhdcfvngcdgsllldnsdt
iesekqaapnnnsargfdvvdniktavenacpgvvscadiltiaaeqsvwlsggpswpvp
lgrrdsltanrtlanqtlpspfltldqlktdfsdqglnttdlvalsgahtfgraqcqffs
qrlynfsatgspdptlnttlletlrnicpqggngstitnldqttpdafdnkyfsnlqtqy
gilqtdqelfstkganttaivtkfsanqsaffnsfvasmikmgnigvltxdegeirsncr
svngga

SCOPe Domain Coordinates for d4cuoa_:

Click to download the PDB-style file with coordinates for d4cuoa_.
(The format of our PDB-style files is described here.)

Timeline for d4cuoa_: