Lineage for d4cspa1 (4csp A:2-159)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367152Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2367811Protein automated matches [226877] (4 species)
    not a true protein
  7. 2367814Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries)
  8. 2367843Domain d4cspa1: 4csp A:2-159 [257749]
    automated match to d1gs7a1
    complexed with cu, mes, zn; mutant

Details for d4cspa1

PDB Entry: 4csp (more details), 1.7 Å

PDB Description: structure of the f306c mutant of nitrite reductase from achromobacter xylosoxidans
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d4cspa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cspa1 b.6.1.3 (A:2-159) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

SCOPe Domain Coordinates for d4cspa1:

Click to download the PDB-style file with coordinates for d4cspa1.
(The format of our PDB-style files is described here.)

Timeline for d4cspa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cspa2