![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
![]() | Protein automated matches [190670] (7 species) not a true protein |
![]() | Species Azospirillum brasilense [TaxId:192] [189362] (11 PDB entries) |
![]() | Domain d4cnzb_: 4cnz B: [257746] automated match to d3mhya_ complexed with adp |
PDB Entry: 4cnz (more details), 1.7 Å
SCOPe Domain Sequences for d4cnzb_:
Sequence, based on SEQRES records: (download)
>d4cnzb_ d.58.5.1 (B:) automated matches {Azospirillum brasilense [TaxId: 192]} mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal
>d4cnzb_ d.58.5.1 (B:) automated matches {Azospirillum brasilense [TaxId: 192]} mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgsflpkvkvevavsddqyeq vveaiqkaantgrigdgkifvldiaqavrirtgetnteal
Timeline for d4cnzb_: