Lineage for d4cmha_ (4cmh A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1588801Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 1588845Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 1588846Protein ADP ribosyl cyclase [56631] (4 species)
  7. 1588871Species Human (Homo sapiens) [TaxId:9606] [159490] (35 PDB entries)
    Uniprot P28907 45-291
  8. 1588891Domain d4cmha_: 4cmh A: [257743]
    Other proteins in same PDB: d4cmhc1, d4cmhc2
    automated match to d1zvmc_

Details for d4cmha_

PDB Entry: 4cmh (more details), 1.53 Å

PDB Description: crystal structure of cd38 with a novel cd38-targeting antibody sar650984
PDB Compounds: (A:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d4cmha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cmha_ c.23.14.3 (A:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
qqwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyq
plmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefatsk
inyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvev
hnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkflqc

SCOPe Domain Coordinates for d4cmha_:

Click to download the PDB-style file with coordinates for d4cmha_.
(The format of our PDB-style files is described here.)

Timeline for d4cmha_: