![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) ![]() |
![]() | Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
![]() | Protein automated matches [190694] (3 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [237934] (4 PDB entries) |
![]() | Domain d4c4ba_: 4c4b A: [257731] automated match to d4bfkb_ complexed with edo, fe2 |
PDB Entry: 4c4b (more details), 2.5 Å
SCOPe Domain Sequences for d4c4ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c4ba_ b.1.13.1 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} melfqtadwkkvkhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegs kfpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgea tlsle
Timeline for d4c4ba_: