Lineage for d4byya2 (4byy A:148-226)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308075Species Corynebacterium glutamicum [TaxId:1718] [226340] (2 PDB entries)
  8. 2308082Domain d4byya2: 4byy A:148-226 [257730]
    Other proteins in same PDB: d4byya1, d4byyb1
    automated match to d3r6sc2
    complexed with gol, po4

Details for d4byya2

PDB Entry: 4byy (more details), 2.48 Å

PDB Description: Apo GlxR
PDB Compounds: (A:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d4byya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4byya2 a.4.5.0 (A:148-226) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dvpgrvaktllqlanrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwi
rlegksvlivdtehlarra

SCOPe Domain Coordinates for d4byya2:

Click to download the PDB-style file with coordinates for d4byya2.
(The format of our PDB-style files is described here.)

Timeline for d4byya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4byya1