SCOPe 2.07: Domain d4byya2: 4byy A:148-226

Lineage for d4byya2 (4byy A:148-226)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [226340] (2 PDB entries)

8. Domain d4byya2: 4byy A:148-226 [257730]
   Other proteins in same PDB: d4byya1, d4byyb1
   automated match to d3r6sc2
   complexed with gol, po4

Details for d4byya2

PDB Entry: 4byy, 2.48 Å

PDB Description: Apo GlxR

PDB Compounds: (A:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d4byya2:

Sequence; same for both SEQRES and ATOM records:

>d4byya2 a.4.5.0 (A:148-226) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dvpgrvaktllqlanrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwi
rlegksvlivdtehlarra

Timeline for d4byya2:

• d4byya2 first appeared in SCOPe 2.04
  
• d4byya2 appears in SCOPe 2.06
  
• d4byya2 appears in the current release, SCOPe 2.08