| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (52 species) not a true protein |
| Species Corynebacterium glutamicum [TaxId:1718] [226340] (2 PDB entries) |
| Domain d4byya2: 4byy A:148-226 [257730] Other proteins in same PDB: d4byya1, d4byyb1 automated match to d3r6sc2 complexed with gol, po4 |
PDB Entry: 4byy (more details), 2.48 Å
SCOPe Domain Sequences for d4byya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4byya2 a.4.5.0 (A:148-226) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dvpgrvaktllqlanrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwi
rlegksvlivdtehlarra
Timeline for d4byya2: