| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Corynebacterium glutamicum [TaxId:1718] [226340] (2 PDB entries) |
| Domain d4byyb2: 4byy B:148-217 [257729] Other proteins in same PDB: d4byya1, d4byyb1 automated match to d3r6sc2 complexed with gol, po4 |
PDB Entry: 4byy (more details), 2.48 Å
SCOPe Domain Sequences for d4byyb2:
Sequence, based on SEQRES records: (download)
>d4byyb2 a.4.5.0 (B:148-217) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dvpgrvaktllqlanrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwi
rlegksvliv
>d4byyb2 a.4.5.0 (B:148-217) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dvpgrvaktllqlanrfltqeeiaqlvgasretvnkalatfahrgwirlegksvliv
Timeline for d4byyb2: