Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (11 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:1718] [226339] (2 PDB entries) |
Domain d4byyb1: 4byy B:3-147 [257727] Other proteins in same PDB: d4byya2, d4byyb2 automated match to d3r6sa1 complexed with gol, po4 |
PDB Entry: 4byy (more details), 2.48 Å
SCOPe Domain Sequences for d4byyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4byyb1 b.82.3.0 (B:3-147) automated matches {Corynebacterium glutamicum [TaxId: 1718]} gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai aeqllrvlarrlrrtnasladlift
Timeline for d4byyb1: