SCOPe 2.08: Domain d4byyb1: 4byy B:3-147

Lineage for d4byyb1 (4byy B:3-147)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (20 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [226339] (2 PDB entries)

8. Domain d4byyb1: 4byy B:3-147 [257727]
   Other proteins in same PDB: d4byya2, d4byyb2
   automated match to d3r6sa1
   complexed with gol, po4

Details for d4byyb1

PDB Entry: 4byy, 2.48 Å

PDB Description: Apo GlxR

PDB Compounds: (B:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d4byyb1:

Sequence; same for both SEQRES and ATOM records:

>d4byyb1 b.82.3.0 (B:3-147) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar
hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai
aeqllrvlarrlrrtnasladlift

Timeline for d4byyb1:

• d4byyb1 first appeared in SCOPe 2.04
  
• d4byyb1 appears in SCOPe 2.07