Lineage for d4bwtb_ (4bwt B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774128Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1774599Protein Pseudoazurin [49522] (4 species)
  7. 1774621Species Thiosphaera pantotropha [TaxId:82367] [49526] (5 PDB entries)
  8. 1774627Domain d4bwtb_: 4bwt B: [257725]
    automated match to d1adwa_
    complexed with cu, so4

Details for d4bwtb_

PDB Entry: 4bwt (more details), 1.76 Å

PDB Description: Three-dimensional structure of Paracoccus pantotrophus pseudoazurin at pH 6.5
PDB Compounds: (B:) pseudoazurin

SCOPe Domain Sequences for d4bwtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bwtb_ b.6.1.1 (B:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]}
athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
qvn

SCOPe Domain Coordinates for d4bwtb_:

Click to download the PDB-style file with coordinates for d4bwtb_.
(The format of our PDB-style files is described here.)

Timeline for d4bwtb_: