Class g: Small proteins [56992] (92 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein automated matches [226950] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225942] (11 PDB entries) |
Domain d4bv7a_: 4bv7 A: [257713] automated match to d3kiva_ complexed with act, bv7 |
PDB Entry: 4bv7 (more details), 1.7 Å
SCOPe Domain Sequences for d4bv7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bv7a_ g.14.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp wcftmdpsirweycaltrc
Timeline for d4bv7a_: