Class a: All alpha proteins [46456] (285 folds) |
Fold a.135: Tetraspanin [48651] (1 superfamily) 5 helices: irregular disulfide-linked array; form homodimer |
Superfamily a.135.1: Tetraspanin [48652] (1 family) |
Family a.135.1.1: Tetraspanin [48653] (2 proteins) |
Protein automated matches [256548] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [256549] (3 PDB entries) |
Domain d4btob_: 4bto B: [257712] automated match to d1g8qa_ complexed with eoh |
PDB Entry: 4bto (more details), 2.4 Å
SCOPe Domain Sequences for d4btob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4btob_ a.135.1.1 (B:) automated matches {Homo sapiens [TaxId: 9606]} vnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknn lcpsgsniisnlfkedchqkiddlfsgkh
Timeline for d4btob_: