| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.135: Tetraspanin [48651] (1 superfamily) 5 helices: irregular disulfide-linked array; form homodimer |
Superfamily a.135.1: Tetraspanin [48652] (1 family) ![]() |
| Family a.135.1.1: Tetraspanin [48653] (2 proteins) |
| Protein automated matches [256548] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries) |
| Domain d4btod1: 4bto D:114-201 [257710] Other proteins in same PDB: d4btoa2, d4btob2, d4btoc2, d4btod2 complexed with eoh complexed with eoh |
PDB Entry: 4bto (more details), 2.4 Å
SCOPe Domain Sequences for d4btod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4btod1 a.135.1.1 (D:114-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknn
lcpsgsniisnlfkedchqkiddlfsgk
Timeline for d4btod1: