Lineage for d4btod1 (4bto D:114-201)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733570Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2733571Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2733572Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2733579Protein automated matches [256548] (3 species)
    not a true protein
  7. 2733582Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries)
  8. 2733600Domain d4btod1: 4bto D:114-201 [257710]
    Other proteins in same PDB: d4btoa2, d4btob2, d4btoc2, d4btod2
    complexed with eoh
    complexed with eoh

Details for d4btod1

PDB Entry: 4bto (more details), 2.4 Å

PDB Description: Multiple LEL structures
PDB Compounds: (D:) CD81 antigen

SCOPe Domain Sequences for d4btod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4btod1 a.135.1.1 (D:114-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknn
lcpsgsniisnlfkedchqkiddlfsgk

SCOPe Domain Coordinates for d4btod1:

Click to download the PDB-style file with coordinates for d4btod1.
(The format of our PDB-style files is described here.)

Timeline for d4btod1: