Lineage for d4btna_ (4btn A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733570Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2733571Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2733572Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2733579Protein automated matches [256548] (3 species)
    not a true protein
  7. 2733582Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries)
  8. 2733591Domain d4btna_: 4btn A: [257708]
    complexed with po4
    complexed with po4

Details for d4btna_

PDB Entry: 4btn (more details), 2.05 Å

PDB Description: Multiple LEL structures
PDB Compounds: (A:) CD81 antigen

SCOPe Domain Sequences for d4btna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4btna_ a.135.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknnl
cpsgsniisnlfkedchqkiddlfsgk

SCOPe Domain Coordinates for d4btna_:

Click to download the PDB-style file with coordinates for d4btna_.
(The format of our PDB-style files is described here.)

Timeline for d4btna_: