Lineage for d4btnc_ (4btn C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750813Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 1750814Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 1750815Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 1750822Protein automated matches [256548] (3 species)
    not a true protein
  7. 1750825Species Human (Homo sapiens) [TaxId:9606] [256549] (6 PDB entries)
  8. 1750832Domain d4btnc_: 4btn C: [257704]
    complexed with po4
    complexed with po4

Details for d4btnc_

PDB Entry: 4btn (more details), 2.05 Å

PDB Description: Multiple LEL structures
PDB Compounds: (C:) CD81 antigen

SCOPe Domain Sequences for d4btnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4btnc_ a.135.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknnl
cpsgsniisnlfkedchqkiddlfsgk

SCOPe Domain Coordinates for d4btnc_:

Click to download the PDB-style file with coordinates for d4btnc_.
(The format of our PDB-style files is described here.)

Timeline for d4btnc_: