Class a: All alpha proteins [46456] (286 folds) |
Fold a.135: Tetraspanin [48651] (1 superfamily) 5 helices: irregular disulfide-linked array; form homodimer |
Superfamily a.135.1: Tetraspanin [48652] (1 family) |
Family a.135.1.1: Tetraspanin [48653] (2 proteins) |
Protein automated matches [256548] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256549] (6 PDB entries) |
Domain d4btnc_: 4btn C: [257704] complexed with po4 complexed with po4 |
PDB Entry: 4btn (more details), 2.05 Å
SCOPe Domain Sequences for d4btnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4btnc_ a.135.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknnl cpsgsniisnlfkedchqkiddlfsgk
Timeline for d4btnc_: