SCOPe 2.05: Domain d4uona_: 4uon A:

Lineage for d4uona_ (4uon A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (4 species)
   not a true protein

7. Species Aura virus [TaxId:44158] [194195] (3 PDB entries)

8. Domain d4uona_: 4uon A: [257700]
   automated match to d1kxfa_
   complexed with gol

Details for d4uona_

PDB Entry: 4uon, 1.81 Å

PDB Description: Crystal structure of C-terminal truncated (110-265) Aura virus capsid protease.

PDB Compounds: (A:) capsid protease

SCOPe Domain Sequences for d4uona_:

Sequence; same for both SEQRES and ATOM records:

>d4uona_ b.47.1.3 (A:) automated matches {Aura virus [TaxId: 44158]}
hmalkfeadrtfavknedgkimgyavamegkvikplhvkgtidhpalaklkftksssydm
efaklptemksdafgyttehpegfynwhhgavqfsggrftiptgaggpgdsgrpildnsg
kvvaivlgganegartalsvvtwnkkgaaiktth

Timeline for d4uona_:

• d4uona_ first appeared in SCOPe 2.04
  
• d4uona_ is called d4uona1 in SCOPe 2.06
  
• d4uona_ appears in the current release, SCOPe 2.08, called d4uona1