SCOPe 2.06: Domain d4tlja_: 4tlj A:

Lineage for d4tlja_ (4tlj A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (4 species)

7. Species Goat (Capra hircus) [TaxId:9925] [267757] (2 PDB entries)

8. Domain d4tlja_: 4tlj A: [257697]
   automated match to d4nlja_
   complexed with bu1

Details for d4tlja_

PDB Entry: 4tlj, 1.17 Å

PDB Description: ultra-high resolution crystal structure of caprine beta-lactoglobulin

PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d4tlja_:

Sequence; same for both SEQRES and ATOM records:

>d4tlja_ b.60.1.1 (A:) beta-Lactoglobulin {Goat (Capra hircus) [TaxId: 9925]}
iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevdkealekfdkalkalpmhirlafnptqlegqchv

Timeline for d4tlja_:

• d4tlja_ first appeared in SCOPe 2.04
  
• d4tlja_ appears in SCOPe 2.05
  
• d4tlja_ appears in SCOPe 2.07
  
• d4tlja_ appears in the current release, SCOPe 2.08