Lineage for d4tnna_ (4tnn A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805489Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
    bacterial metal-binding, lipocalin-like protein
    automatically mapped to Pfam PF09223
  6. 2805490Protein Hypothetical protein YodA [101864] (3 species)
  7. 2805491Species Escherichia coli [TaxId:1403831] [257694] (1 PDB entry)
  8. 2805492Domain d4tnna_: 4tnn A: [257695]
    automated match to d1oeja_
    complexed with ni, so4

Details for d4tnna_

PDB Entry: 4tnn (more details), 1.95 Å

PDB Description: crystal structure of escherichia coli protein yoda in complex with ni - artifact of purification.
PDB Compounds: (A:) Metal-binding lipocalin

SCOPe Domain Sequences for d4tnna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tnna_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 1403831]}
hghhshgkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkad
adktktfaeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkk
gvrylfeckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyq
lsseevveemmsh

SCOPe Domain Coordinates for d4tnna_:

Click to download the PDB-style file with coordinates for d4tnna_.
(The format of our PDB-style files is described here.)

Timeline for d4tnna_: