Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins) bacterial metal-binding, lipocalin-like protein automatically mapped to Pfam PF09223 |
Protein Hypothetical protein YodA [101864] (3 species) |
Species Escherichia coli [TaxId:1403831] [257694] (1 PDB entry) |
Domain d4tnna_: 4tnn A: [257695] automated match to d1oeja_ complexed with ni, so4 |
PDB Entry: 4tnn (more details), 1.95 Å
SCOPe Domain Sequences for d4tnna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tnna_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 1403831]} hghhshgkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkad adktktfaeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkk gvrylfeckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyq lsseevveemmsh
Timeline for d4tnna_: