SCOPe 2.08: Domain d4qfwc1: 4qfw C:4-115

Lineage for d4qfwc1 (4qfw C:4-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [257672] (3 PDB entries)

8. Domain d4qfwc1: 4qfw C:4-115 [257673]
   automated match to d1c8ua1

Details for d4qfwc1

PDB Entry: 4qfw, 2 Å

PDB Description: crystal structure of acyl-coa thioesterase tesb from yersinia pestis

PDB Compounds: (C:) acyl-coa thioesterase II

SCOPe Domain Sequences for d4qfwc1:

Sequence, based on SEQRES records:

>d4qfwc1 d.38.1.0 (C:4-115) automated matches {Yersinia pestis [TaxId: 632]}
aleklldlldlekieegifrgqsedlglrqvfggqvvgqaiyaakqtvpaertvhsfhsy
flrpgdsskpiiydvetlrdgnsfsarrvsaiqngkpifymtasfqsqeegf

Sequence, based on observed residues (ATOM records):

>d4qfwc1 d.38.1.0 (C:4-115) automated matches {Yersinia pestis [TaxId: 632]}
aleklldlldlekieegifrgqseqvfggqvvgqaiyaakqtvpaertvhsfhsyflrpg
dsskpiiydvetlrdgnsfsarrvsaiqngkpifymtasfqsqeegf

Timeline for d4qfwc1:

• d4qfwc1 first appeared in SCOPe 2.04
  
• d4qfwc1 appears in SCOPe 2.07