Lineage for d4qf8a_ (4qf8 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505317Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1505318Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1505323Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1505431Protein Snake phospholipase A2 [48624] (36 species)
  7. 1505620Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (35 PDB entries)
    Uniprot P59071
  8. 1505647Domain d4qf8a_: 4qf8 A: [257670]
    automated match to d1tk4a_
    complexed with so4, spd

Details for d4qf8a_

PDB Entry: 4qf8 (more details), 1.65 Å

PDB Description: Crystal Structure of the Complex of Phospholipase A2 with Spermidine at 1.65 A Resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d4qf8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qf8a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d4qf8a_:

Click to download the PDB-style file with coordinates for d4qf8a_.
(The format of our PDB-style files is described here.)

Timeline for d4qf8a_: