![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein Achromobacter protease [50496] (1 species) |
![]() | Species Achromobacter lyticus, strain m497-1 [TaxId:224] [50497] (3 PDB entries) |
![]() | Domain d1arca_: 1arc A: [25767] complexed with tck |
PDB Entry: 1arc (more details), 2 Å
SCOPe Domain Sequences for d1arca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1arca_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa asrlsdwldpastgaqfidglds
Timeline for d1arca_: