Lineage for d1arca_ (1arc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404159Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2404160Protein Achromobacter protease [50496] (1 species)
  7. 2404161Species Achromobacter lyticus, strain m497-1 [TaxId:224] [50497] (3 PDB entries)
  8. 2404164Domain d1arca_: 1arc A: [25767]
    complexed with tck

Details for d1arca_

PDB Entry: 1arc (more details), 2 Å

PDB Description: the primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease
PDB Compounds: (A:) achromobacter protease I

SCOPe Domain Sequences for d1arca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arca_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]}
gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
asrlsdwldpastgaqfidglds

SCOPe Domain Coordinates for d1arca_:

Click to download the PDB-style file with coordinates for d1arca_.
(The format of our PDB-style files is described here.)

Timeline for d1arca_: