Lineage for d1arc__ (1arc -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111586Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins)
  6. 111587Protein Achromobacter protease [50496] (1 species)
  7. 111588Species Achromobacter lyticus, strain m497-1 [TaxId:224] [50497] (2 PDB entries)
  8. 111590Domain d1arc__: 1arc - [25767]

Details for d1arc__

PDB Entry: 1arc (more details), 2 Å

PDB Description: the primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease

SCOP Domain Sequences for d1arc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arc__ b.47.1.1 (-) Achromobacter protease {Achromobacter lyticus, strain m497-1}
gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
asrlsdwldpastgaqfidglds

SCOP Domain Coordinates for d1arc__:

Click to download the PDB-style file with coordinates for d1arc__.
(The format of our PDB-style files is described here.)

Timeline for d1arc__: