Lineage for d4qeza_ (4qez A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2126300Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2126301Protein automated matches [190781] (41 species)
    not a true protein
  7. 2126315Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [257666] (1 PDB entry)
  8. 2126316Domain d4qeza_: 4qez A: [257667]
    Other proteins in same PDB: d4qezb2, d4qezc2
    automated match to d3dp9c_
    complexed with ade, trs

Details for d4qeza_

PDB Entry: 4qez (more details), 2.7 Å

PDB Description: Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Bacillus anthracis
PDB Compounds: (A:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4qeza_:

Sequence, based on SEQRES records: (download)

>d4qeza_ c.56.2.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
riavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstti
llerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfka
dealvalaekcmqaeeniqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaavaq
vchqyevpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleel

Sequence, based on observed residues (ATOM records): (download)

>d4qeza_ c.56.2.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
riavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstti
llerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfka
dealvalaekcmqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaavaqvchqye
vpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleel

SCOPe Domain Coordinates for d4qeza_:

Click to download the PDB-style file with coordinates for d4qeza_.
(The format of our PDB-style files is described here.)

Timeline for d4qeza_: