Lineage for d1arb__ (1arb -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14825Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins)
  6. 14826Protein Achromobacter protease [50496] (1 species)
  7. 14827Species Achromobacter lyticus, strain m497-1 [TaxId:224] [50497] (2 PDB entries)
  8. 14828Domain d1arb__: 1arb - [25766]

Details for d1arb__

PDB Entry: 1arb (more details), 1.2 Å

PDB Description: the primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease

SCOP Domain Sequences for d1arb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arb__ b.47.1.1 (-) Achromobacter protease {Achromobacter lyticus, strain m497-1}
gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
asrlsdwldpastgaqfidglds

SCOP Domain Coordinates for d1arb__:

Click to download the PDB-style file with coordinates for d1arb__.
(The format of our PDB-style files is described here.)

Timeline for d1arb__: