Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) |
Family b.1.6.1: Cadherin [49314] (3 proteins) |
Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries) |
Domain d4qd2e2: 4qd2 E:102-213 [257659] Other proteins in same PDB: d4qd2c1, d4qd2d1, d4qd2d2 automated match to d1ff5a2 complexed with ca |
PDB Entry: 4qd2 (more details), 2.4 Å
SCOPe Domain Sequences for d4qd2e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qd2e2 b.1.6.1 (E:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkd
Timeline for d4qd2e2: