| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
| Domain d4qc1a1: 4qc1 A:2062-2165 [257653] Other proteins in same PDB: d4qc1a2, d4qc1b2 automated match to d2e7oa_ complexed with so4, zn |
PDB Entry: 4qc1 (more details), 1.99 Å
SCOPe Domain Sequences for d4qc1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qc1a1 a.29.2.0 (A:2062-2165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstireklssgqypn
letfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtf
Timeline for d4qc1a1: