Lineage for d1bnka_ (1bnk A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14807Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
  4. 14808Superfamily b.46.1: FMT C-terminal domain-like [50486] (2 families) (S)
  5. 14816Family b.46.1.2: 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) [50490] (1 protein)
  6. 14817Protein 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) [50491] (1 species)
  7. 14818Species Human (Homo sapiens) [TaxId:9606] [50492] (4 PDB entries)
  8. 14822Domain d1bnka_: 1bnk A: [25765]

Details for d1bnka_

PDB Entry: 1bnk (more details), 2.7 Å

PDB Description: human 3-methyladenine dna glycosylase complexed to dna

SCOP Domain Sequences for d1bnka_:

Sequence, based on SEQRES records: (download)

>d1bnka_ b.46.1.2 (A:) 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) {Human (Homo sapiens)}
kghltrlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrg
grqtprnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrhvrsq
lrkgtasrvlkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaa
arvgvghagewarkplrfyvrgspwvsvvdrvaeqd

Sequence, based on observed residues (ATOM records): (download)

>d1bnka_ b.46.1.2 (A:) 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) {Human (Homo sapiens)}
kghltrlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrg
grqtprnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrsr
vlkdrelcsgpsklcqalainksfdqrdlaqdeavwleravvaaarvgvghagewarkpl
rfyvrgspwvsvvdrvaeqd

SCOP Domain Coordinates for d1bnka_:

Click to download the PDB-style file with coordinates for d1bnka_.
(The format of our PDB-style files is described here.)

Timeline for d1bnka_: