SCOPe 2.08: Domain d4qava2: 4qav A:254-414

Lineage for d4qava2 (4qav A:254-414)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:662598] [257644] (1 PDB entry)

8. Domain d4qava2: 4qav A:254-414 [257647]
   automated match to d4ls6a2
   complexed with fmt, k

Details for d4qava2

PDB Entry: 4qav, 2.1 Å

PDB Description: The structure of Beta-ketoacyl -(acyl carrier protein) synthase II (FabF) from Neisseria meningitidis

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4qava2:

Sequence; same for both SEQRES and ATOM records:

>d4qava2 c.95.1.0 (A:254-414) automated matches {Neisseria meningitidis [TaxId: 662598]}
kiyaeivgfgmssdayhitapneegpalavtralkdaginpedvdyvnahgtstplgdan
etkalkrafgehayktvvsstksmtghllgaaggveavysilaihdgkipptinifeqdv
eagcdldycaneardaeidvaisnsfgfggtngtlvfkrfk

Timeline for d4qava2:

• d4qava2 first appeared in SCOPe 2.04
  
• d4qava2 appears in SCOPe 2.07