SCOPe 2.05: Domain d4q9wa_: 4q9w A:

Lineage for d4q9wa_ (4q9w A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (20 species)
   not a true protein

7. Species Clavularia sp. [TaxId:86521] [188532] (6 PDB entries)

8. Domain d4q9wa_: 4q9w A: [257641]
   automated match to d2btja_

Details for d4q9wa_

PDB Entry: 4q9w, 1 Å

PDB Description: mTFP*: a robust and versatile host protein at 1.00 A resolution

PDB Compounds: (A:) GFP-like fluorescent chromoprotein cFP484

SCOPe Domain Sequences for d4q9wa_:

Sequence; same for both SEQRES and ATOM records:

>d4q9wa_ d.22.1.0 (A:) automated matches {Clavularia sp. [TaxId: 86521]}
sgvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydiltta
fxnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkg
enfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakka
vklpdyhfvdhrieilnydkdynkvtvyesavarnstd

Timeline for d4q9wa_:

• d4q9wa_ first appeared in SCOPe 2.04
  
• d4q9wa_ is called d4q9wa1 in SCOPe 2.06
  
• d4q9wa_ appears in the current release, SCOPe 2.08, called d4q9wa1