Lineage for d1f4ra_ (1f4r A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404074Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2404075Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2404109Family b.46.1.2: 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) [50490] (2 proteins)
    automatically mapped to Pfam PF02245
  6. 2404110Protein 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) [50491] (1 species)
  7. 2404111Species Human (Homo sapiens) [TaxId:9606] [50492] (4 PDB entries)
  8. 2404114Domain d1f4ra_: 1f4r A: [25764]
    protein/DNA complex; complexed with na

Details for d1f4ra_

PDB Entry: 1f4r (more details), 2.4 Å

PDB Description: crystal structure of the human aag dna repair glycosylase complexed with 1,n6-ethenoadenine-dna
PDB Compounds: (A:) 3-methyl-adenine DNA glycosylase

SCOPe Domain Sequences for d1f4ra_:

Sequence, based on SEQRES records: (download)

>d1f4ra_ b.46.1.2 (A:) 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) {Human (Homo sapiens) [TaxId: 9606]}
hltrlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrggr
qtprnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstlr
kgtasrvlkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaaar
vgvghagewarkplrfyvrgspwvsvvdrvaeq

Sequence, based on observed residues (ATOM records): (download)

>d1f4ra_ b.46.1.2 (A:) 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) {Human (Homo sapiens) [TaxId: 9606]}
hltrlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrggr
qtprnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstvl
kdrelcsgpsklcqalainksfdqrdlaqdeavwlergpavvaaarvgvghagewarkpl
rfyvrgspwvsvvdrvaeq

SCOPe Domain Coordinates for d1f4ra_:

Click to download the PDB-style file with coordinates for d1f4ra_.
(The format of our PDB-style files is described here.)

Timeline for d1f4ra_: