Lineage for d4q9aa_ (4q9a A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116451Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2116572Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2116573Protein automated matches [191059] (12 species)
    not a true protein
  7. 2116612Species Parabacteroides merdae [TaxId:411477] [257634] (1 PDB entry)
  8. 2116613Domain d4q9aa_: 4q9a A: [257636]
    automated match to d4jhla_

Details for d4q9aa_

PDB Entry: 4q9a (more details), 2.86 Å

PDB Description: crystal structure of a putative gdsl-like lipase (parmer_00689) from parabacteroides merdae atcc 43184 at 2.86 a resolution
PDB Compounds: (A:) Tat pathway signal sequence domain protein

SCOPe Domain Sequences for d4q9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q9aa_ c.23.10.0 (A:) automated matches {Parabacteroides merdae [TaxId: 411477]}
apkinlkkdcvilfqgdsitdcgrdrnsnrcntmeqfgsgyvlftatqllegkaalqpki
ynrgisgnkvyqlrerweidclafqpdvlsiligvndywhtlthgykgtvetyendlral
lkytkeklpntqivlcepftlrdgaaiedskwypmfdefrksarklseefntifvpfqsg
fdaavklaparywsndgvhpdlpgrqlmanmwmeatglk

SCOPe Domain Coordinates for d4q9aa_:

Click to download the PDB-style file with coordinates for d4q9aa_.
(The format of our PDB-style files is described here.)

Timeline for d4q9aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4q9ab_