Lineage for d4q7na2 (4q7n A:241-308)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2942022Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 2942023Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (9 PDB entries)
    Uniprot Q7YS85
  8. 2942024Domain d4q7na2: 4q7n A:241-308 [257630]
    Other proteins in same PDB: d4q7na1
    automated match to d1tfva2
    complexed with 2zo, nag

Details for d4q7na2

PDB Entry: 4q7n (more details), 1.79 Å

PDB Description: crystal structure of the complex of buffalo signalling protein spb-40 with 4-n-trimethylaminobutyraldehyde at 1.79 angstrom resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d4q7na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q7na2 d.26.3.1 (A:241-308) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk
gnqwvayd

SCOPe Domain Coordinates for d4q7na2:

Click to download the PDB-style file with coordinates for d4q7na2.
(The format of our PDB-style files is described here.)

Timeline for d4q7na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4q7na1