Lineage for d4q7na1 (4q7n A:1-240,A:309-362)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831708Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2831895Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 2831896Species Buffalo (Bubalus bubalis) [TaxId:89462] [110353] (9 PDB entries)
    Uniprot Q7YS85
  8. 2831897Domain d4q7na1: 4q7n A:1-240,A:309-362 [257629]
    Other proteins in same PDB: d4q7na2
    automated match to d1tfva1
    complexed with 2zo, nag

Details for d4q7na1

PDB Entry: 4q7n (more details), 1.79 Å

PDB Description: crystal structure of the complex of buffalo signalling protein spb-40 with 4-n-trimethylaminobutyraldehyde at 1.79 angstrom resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d4q7na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q7na1 c.1.8.5 (A:1-240,A:309-362) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnygsqrfskiasktqsrrtfiksvppflrthgfdgldlawlw
pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptfX
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlarv

SCOPe Domain Coordinates for d4q7na1:

Click to download the PDB-style file with coordinates for d4q7na1.
(The format of our PDB-style files is described here.)

Timeline for d4q7na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4q7na2