| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Leptospira biflexa [TaxId:355278] [257624] (1 PDB entry) |
| Domain d4q7eb_: 4q7e B: [257626] automated match to d1j56a_ complexed with gol, so4 |
PDB Entry: 4q7e (more details), 1.44 Å
SCOPe Domain Sequences for d4q7eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q7eb_ c.23.1.0 (B:) automated matches {Leptospira biflexa [TaxId: 355278]}
kprillveddeglgetlkerleqdkyrvewaktiseaenlyrpnafdlvvldlrlpdgng
fdlaemivkkekdlpflfltaqagaqerlrgfelgaaefipkpfhlkeflirlervislt
rphy
Timeline for d4q7eb_: