Lineage for d4q60b1 (4q60 B:2-310)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164557Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2164558Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2164670Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2164671Protein automated matches [190491] (15 species)
    not a true protein
  7. 2164685Species Burkholderia multivorans [TaxId:395019] [226654] (2 PDB entries)
  8. 2164688Domain d4q60b1: 4q60 B:2-310 [257620]
    Other proteins in same PDB: d4q60a2, d4q60b2
    automated match to d4k7gd_
    complexed with gol, pyc

Details for d4q60b1

PDB Entry: 4q60 (more details), 2.1 Å

PDB Description: Crystal structure of a 4-hydroxyproline epimerase from Burkholderia Multivorans atcc 17616, target EFI-506586, open form, with bound pyrrole-2-carboxylate
PDB Compounds: (B:) proline racemase

SCOPe Domain Sequences for d4q60b1:

Sequence, based on SEQRES records: (download)

>d4q60b1 d.21.1.0 (B:2-310) automated matches {Burkholderia multivorans [TaxId: 395019]}
mkriqiidshtggeptrlvvsgfpslgsgtmaerrdvlareydryrtacileprgsdvlv
gallcepvspdaaagviffnnsgylgmcghgtigvvrtlhhmgrigpgvhrietpvgtve
atlhddlsvsvrnvlayrhakdvaldvpgygpvrgdiawggnwfflisdhgqrvagdnva
altayasavregleragitganggeidhielfaddpehdsrsfvlcpglaydrspcgtgt
saklaclaadgklapgavwrqasvigsvfhasyvqaeggivptirgsahlsaeatllied
ddpfrwgiv

Sequence, based on observed residues (ATOM records): (download)

>d4q60b1 d.21.1.0 (B:2-310) automated matches {Burkholderia multivorans [TaxId: 395019]}
mkriqiidshtggeptrlvvsgfpslgsgtmaerrdvlareydryrtacileprgsdvlv
gallcepvspdaaagviffnnsgylgmcghgtigvvrtlhhmgrigpgvhrietpvgtve
atlhddlsvsvrnvlayrhakdvaldvpgygpvrgdiawggnwfflisdhgqrvagdnva
altayasavregleragitganggeidhielfaddpehdsrsfvlcpgrspcgtgtsakl
aclaadgklapgavwrqasvigsvfhasyvqaeggivptirgsahlsaeatlliedddpf
rwgiv

SCOPe Domain Coordinates for d4q60b1:

Click to download the PDB-style file with coordinates for d4q60b1.
(The format of our PDB-style files is described here.)

Timeline for d4q60b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4q60b2