Lineage for d1ewna_ (1ewn A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793015Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 1793016Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 1793049Family b.46.1.2: 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) [50490] (2 proteins)
    automatically mapped to Pfam PF02245
  6. 1793050Protein 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) [50491] (1 species)
  7. 1793051Species Human (Homo sapiens) [TaxId:9606] [50492] (4 PDB entries)
  8. 1793052Domain d1ewna_: 1ewn A: [25762]
    protein/DNA complex; complexed with na

Details for d1ewna_

PDB Entry: 1ewn (more details), 2.1 Å

PDB Description: crystal structure of the human aag dna repair glycosylase complexed with 1,n6-ethenoadenine-dna
PDB Compounds: (A:) 3-methyl-adenine DNA glycosylase

SCOPe Domain Sequences for d1ewna_:

Sequence, based on SEQRES records: (download)

>d1ewna_ b.46.1.2 (A:) 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) {Human (Homo sapiens) [TaxId: 9606]}
hltrlgleffdqpavplaraflgqvlvrrlpngtelrgrivetqaylgpedeaahsrggr
qtprnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstlr
kgtasrvlkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaaar
vgvghagewarkplrfyvrgspwvsvvdrvaeqd

Sequence, based on observed residues (ATOM records): (download)

>d1ewna_ b.46.1.2 (A:) 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) {Human (Homo sapiens) [TaxId: 9606]}
hltrlgleffdqpavplaraflgqvlvrrlpngtelrgrivetqaylgpedeaahsrggr
qtprnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstvl
kdrelcsgpsklcqalainksfdqrdlaqdeavwlergpavvaaarvgvghagewarkpl
rfyvrgspwvsvvdrvaeqd

SCOPe Domain Coordinates for d1ewna_:

Click to download the PDB-style file with coordinates for d1ewna_.
(The format of our PDB-style files is described here.)

Timeline for d1ewna_: