Lineage for d4q4la3 (4q4l A:361-476)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717547Species Burkholderia thailandensis [TaxId:271848] [257614] (1 PDB entry)
  8. 2717548Domain d4q4la3: 4q4l A:361-476 [257615]
    Other proteins in same PDB: d4q4la1, d4q4la2
    automated match to d1mabb1
    complexed with na

Details for d4q4la3

PDB Entry: 4q4l (more details), 2.2 Å

PDB Description: Crystal structure of an ATP synthase subunit beta 1 (F1-B1) from Burkholderia thailandensis
PDB Compounds: (A:) ATP synthase subunit beta 1

SCOPe Domain Sequences for d4q4la3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q4la3 a.69.1.0 (A:361-476) automated matches {Burkholderia thailandensis [TaxId: 271848]}
idpnvigeehysitrrvqqtlqrykelrdiiailgmdelspedklsvararkiqrflsqp
fhvaevftgspgkyvplketirgfkmivdgecdhlpeqafymvgtideafekakki

SCOPe Domain Coordinates for d4q4la3:

Click to download the PDB-style file with coordinates for d4q4la3.
(The format of our PDB-style files is described here.)

Timeline for d4q4la3: