![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (17 species) not a true protein |
![]() | Species Burkholderia thailandensis [TaxId:271848] [257614] (1 PDB entry) |
![]() | Domain d4q4la3: 4q4l A:361-476 [257615] Other proteins in same PDB: d4q4la1, d4q4la2 automated match to d1mabb1 complexed with na |
PDB Entry: 4q4l (more details), 2.2 Å
SCOPe Domain Sequences for d4q4la3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q4la3 a.69.1.0 (A:361-476) automated matches {Burkholderia thailandensis [TaxId: 271848]} idpnvigeehysitrrvqqtlqrykelrdiiailgmdelspedklsvararkiqrflsqp fhvaevftgspgkyvplketirgfkmivdgecdhlpeqafymvgtideafekakki
Timeline for d4q4la3: