Lineage for d4q4la2 (4q4l A:92-360)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114014Species Burkholderia thailandensis [TaxId:271848] [196068] (4 PDB entries)
  8. 2114021Domain d4q4la2: 4q4l A:92-360 [257613]
    Other proteins in same PDB: d4q4la1, d4q4la3
    automated match to d1mabb3
    complexed with na

Details for d4q4la2

PDB Entry: 4q4l (more details), 2.2 Å

PDB Description: Crystal structure of an ATP synthase subunit beta 1 (F1-B1) from Burkholderia thailandensis
PDB Compounds: (A:) ATP synthase subunit beta 1

SCOPe Domain Sequences for d4q4la2:

Sequence, based on SEQRES records: (download)

>d4q4la2 c.37.1.0 (A:92-360) automated matches {Burkholderia thailandensis [TaxId: 271848]}
isvpvgkptlgrimdvlgrpideagpiesenkrsihqkapafdelspstelletgikvid
licpfakggkvglfggagvgktvnmmelinniakehggysvfagvgertregndfyhemk
dsnvldkvalvygqmneppgnrlrvaltgltmaehfrdegldvlffvdniyrftlagtev
sallgrmpsavgyqptlaeemgklqeritstkkgsitsvqavyvpaddltdpspattfgh
ldatvvlsrdiaslgiypavdpldstsrq

Sequence, based on observed residues (ATOM records): (download)

>d4q4la2 c.37.1.0 (A:92-360) automated matches {Burkholderia thailandensis [TaxId: 271848]}
isvpvgkptlgrimdvlgrpideagpiesenkrsihqkapafdelspstelletgikvid
licpfakggkvglfggagvgktvnmmelinniakehggysvfagvndfyhemkdsnvldk
valvygqmneppgnrlrvaltgltmaehfrdegldvlffvdniyrftlagtevsallgrm
psavgyqptlaeemgklqeritstkkgsitsvqavyvpahldatvvlsrdiaslgiypav
dpldstsrq

SCOPe Domain Coordinates for d4q4la2:

Click to download the PDB-style file with coordinates for d4q4la2.
(The format of our PDB-style files is described here.)

Timeline for d4q4la2: