Lineage for d4q3ha_ (4q3h A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786234Protein automated matches [190055] (6 species)
    not a true protein
  7. 2786243Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries)
  8. 2786266Domain d4q3ha_: 4q3h A: [257610]
    automated match to d2ozfa_

Details for d4q3ha_

PDB Entry: 4q3h (more details), 1.44 Å

PDB Description: the crystal structure of nherf1 pdz2 cxcr2 complex revealed by the nherf1 cxcr2 chimeric protein
PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF1

SCOPe Domain Sequences for d4q3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q3ha_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrprlctmkkgpsgygfnlhsdkskpgqfirsvdpdspaeasglraqdrivevngvcmeg
kqhgdvvsairaggdetkllvvdretsttl

SCOPe Domain Coordinates for d4q3ha_:

Click to download the PDB-style file with coordinates for d4q3ha_.
(The format of our PDB-style files is described here.)

Timeline for d4q3ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4q3hb_