Lineage for d4q3fb_ (4q3f B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961019Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 2961020Protein D-dopachrome tautomerase [55344] (2 species)
  7. 2961021Species Human (Homo sapiens) [TaxId:9606] [55345] (4 PDB entries)
  8. 2961029Domain d4q3fb_: 4q3f B: [257607]
    automated match to d1dpta_
    complexed with tla

Details for d4q3fb_

PDB Entry: 4q3f (more details), 1.8 Å

PDB Description: Human D-DT complexed with tartrate
PDB Compounds: (B:) D-dopachrome decarboxylase

SCOPe Domain Sequences for d4q3fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q3fb_ d.80.1.3 (B:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]}
pfleldtnlpanrvpaglekrlcaaaasilgkpadrvnvtvrpglamalsgstepcaqls
issigvvgtaednrshsahffefltkelalgqdrilirffpleswqigkigtvmtfl

SCOPe Domain Coordinates for d4q3fb_:

Click to download the PDB-style file with coordinates for d4q3fb_.
(The format of our PDB-style files is described here.)

Timeline for d4q3fb_: