Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.3: MIF-related [55339] (3 proteins) automatically mapped to Pfam PF01187 |
Protein D-dopachrome tautomerase [55344] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55345] (4 PDB entries) |
Domain d4q3fb_: 4q3f B: [257607] automated match to d1dpta_ complexed with tla |
PDB Entry: 4q3f (more details), 1.8 Å
SCOPe Domain Sequences for d4q3fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q3fb_ d.80.1.3 (B:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]} pfleldtnlpanrvpaglekrlcaaaasilgkpadrvnvtvrpglamalsgstepcaqls issigvvgtaednrshsahffefltkelalgqdrilirffpleswqigkigtvmtfl
Timeline for d4q3fb_: