Lineage for d4q34a_ (4q34 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153212Species Parabacteroides distasonis [TaxId:435591] [257605] (1 PDB entry)
  8. 2153213Domain d4q34a_: 4q34 A: [257606]
    automated match to d1qlwb_
    complexed with cl, gol

Details for d4q34a_

PDB Entry: 4q34 (more details), 1.6 Å

PDB Description: crystal structure of a putative esterase (bdi_1566) from parabacteroides distasonis atcc 8503 at 1.60 a resolution
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d4q34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q34a_ c.69.1.0 (A:) automated matches {Parabacteroides distasonis [TaxId: 435591]}
ervlmvdeqgsfavggtvlvdslghtfhgdhayvfyqkpvgarkyplvfahgvgqfsktw
ettpdgregfqniflrrrfcvylvdqprrgnagrgtesvtispafdeevwfnrfrvgiwp
dyfegvqfkrdketldqyfrqmtptigttdfevysdayaalfdkigpgvfithsqggpvg
wntllktrnikaiasyepggavpfpegqlpeeakfitlskkmegievpmsvfmeytkvpi
viyygdnlpetderpelyewtrrlrlmkiwakmlndqggdvtvihlpevglhgnthfpms
dlnnievadllsewlhtkald

SCOPe Domain Coordinates for d4q34a_:

Click to download the PDB-style file with coordinates for d4q34a_.
(The format of our PDB-style files is described here.)

Timeline for d4q34a_: