SCOPe 2.06: Domain d4q2hb_: 4q2h B:

Lineage for d4q2hb_ (4q2h B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (15 species)
   not a true protein

7. Species Agrobacterium radiobacter [TaxId:311403] [257598] (1 PDB entry)

8. Domain d4q2hb_: 4q2h B: [257600]
   Other proteins in same PDB: d4q2ha2
   automated match to d4k7gd_
   complexed with bct, gol

Details for d4q2hb_

PDB Entry: 4q2h, 1.8 Å

PDB Description: crystal structure of probable proline racemase from agrobacterium radiobacter k84, target efi-506561, with bound carbonate

PDB Compounds: (B:) Proline racemase protein

SCOPe Domain Sequences for d4q2hb_:

Sequence; same for both SEQRES and ATOM records:

>d4q2hb_ d.21.1.0 (B:) automated matches {Agrobacterium radiobacter [TaxId: 311403]}
tiqlldvhcegeigrvaiggvpkipgntvaeqlhwlntdpkgeelrrflvleprgapigs
vnlllparhpdadaafiilqpdqahassgsnsicvttallesgivemkepetvvtletaa
glvratatcrdgrcekvrltmvpsfvheldvgidtpqwgrikldlcyggifyalvdvgqi
gltigkanaaslvqagmvlkelinrtvpvvhpeipaisgvayvmfrdidadgairtcttm
wpgradrspcgtgnsanlatlhargkarvgdvfksrsiigsefevglqaetevagkpaii
ptitgrgftfglsqvaldpfdpmangfaltdvwgplagdi

Timeline for d4q2hb_:

• d4q2hb_ first appeared in SCOPe 2.04
  
• d4q2hb_ appears in SCOPe 2.05
  
• d4q2hb_ appears in SCOPe 2.07
  
• d4q2hb_ appears in the current release, SCOPe 2.08