Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (15 species) not a true protein |
Species Agrobacterium radiobacter [TaxId:311403] [257598] (1 PDB entry) |
Domain d4q2hb_: 4q2h B: [257600] Other proteins in same PDB: d4q2ha2 automated match to d4k7gd_ complexed with bct, gol |
PDB Entry: 4q2h (more details), 1.8 Å
SCOPe Domain Sequences for d4q2hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q2hb_ d.21.1.0 (B:) automated matches {Agrobacterium radiobacter [TaxId: 311403]} tiqlldvhcegeigrvaiggvpkipgntvaeqlhwlntdpkgeelrrflvleprgapigs vnlllparhpdadaafiilqpdqahassgsnsicvttallesgivemkepetvvtletaa glvratatcrdgrcekvrltmvpsfvheldvgidtpqwgrikldlcyggifyalvdvgqi gltigkanaaslvqagmvlkelinrtvpvvhpeipaisgvayvmfrdidadgairtcttm wpgradrspcgtgnsanlatlhargkarvgdvfksrsiigsefevglqaetevagkpaii ptitgrgftfglsqvaldpfdpmangfaltdvwgplagdi
Timeline for d4q2hb_: