Lineage for d4q2ha_ (4q2h A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898719Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1898720Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1898822Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 1898823Protein automated matches [190491] (13 species)
    not a true protein
  7. 1898824Species Agrobacterium radiobacter [TaxId:311403] [257598] (1 PDB entry)
  8. 1898825Domain d4q2ha_: 4q2h A: [257599]
    automated match to d4k7gd_
    complexed with bct, gol

Details for d4q2ha_

PDB Entry: 4q2h (more details), 1.8 Å

PDB Description: crystal structure of probable proline racemase from agrobacterium radiobacter k84, target efi-506561, with bound carbonate
PDB Compounds: (A:) Proline racemase protein

SCOPe Domain Sequences for d4q2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q2ha_ d.21.1.0 (A:) automated matches {Agrobacterium radiobacter [TaxId: 311403]}
smrwkrtiqlldvhcegeigrvaiggvpkipgntvaeqlhwlntdpkgeelrrflvlepr
gapigsvnlllparhpdadaafiilqpdqahassgsnsicvttallesgivemkepetvv
tletaaglvratatcrdgrcekvrltmvpsfvheldvgidtpqwgrikldlcyggifyal
vdvgqigltigkanaaslvqagmvlkelinrtvpvvhpeipaisgvayvmfrdidadgai
rtcttmwpgradrspcgtgnsanlatlhargkarvgdvfksrsiigsefevglqaeteva
gkpaiiptitgrgftfglsqvaldpfdpmangfaltdvwgplagdi

SCOPe Domain Coordinates for d4q2ha_:

Click to download the PDB-style file with coordinates for d4q2ha_.
(The format of our PDB-style files is described here.)

Timeline for d4q2ha_: