SCOPe 2.08: Domain d4q14b_: 4q14 B:

Lineage for d4q14b_ (4q14 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (8 species)
   not a true protein

7. Species Brucella melitensis [TaxId:359391] [257596] (1 PDB entry)

8. Domain d4q14b_: 4q14 B: [257597]
   automated match to d3qvaa_
   complexed with cit, cl

Details for d4q14b_

PDB Entry: 4q14, 1.7 Å

PDB Description: crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis

PDB Compounds: (B:) 5-hydroxyisourate hydrolase

SCOPe Domain Sequences for d4q14b_:

Sequence; same for both SEQRES and ATOM records:

>d4q14b_ b.3.4.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
mgklsthvldtahgtpaaamrvelyriaasgtpellkrvvtnldgrtdapllsgdemrtg
iyelqfhvaeyfegrgaelahepfldlipirfgiadedgnyhvpllvspwsystyrgs

Timeline for d4q14b_:

• d4q14b_ first appeared in SCOPe 2.04
  
• d4q14b_ appears in SCOPe 2.07