SCOPe 2.04: Domain d4q0ka_: 4q0k A:

Lineage for d4q0ka_ (4q0k A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (19 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [194255] (6 PDB entries)

8. Domain d4q0ka_: 4q0k A: [257593]
   automated match to d2flhb_
   complexed with ga3, gol

Details for d4q0ka_

PDB Entry: 4q0k, 1.34 Å

PDB Description: Crystal Structure of Phytohormone Binding Protein from Medicago truncatula in complex with gibberellic acid (GA3)

PDB Compounds: (A:) phytohormone binding protein mtphbp

SCOPe Domain Sequences for d4q0ka_:

Sequence; same for both SEQRES and ATOM records:

>d4q0ka_ d.129.3.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
mikefntqttlnvglealwaaqskditlvvpkvlpnivkdvqviegdggvgtklifnflp
giapvnyqreviteydelshtiglqvveggylnqglsyykttfqfsaisenktlvnvkis
ydheselieekvkptktsestlfylgqlekflln

Timeline for d4q0ka_:

• d4q0ka_ is new in SCOPe 2.04-stable
  
• d4q0ka_ appears in SCOPe 2.05
  
• d4q0ka_ appears in the current release, SCOPe 2.08