SCOPe 2.07: Domain d4pzkb_: 4pzk B:

Lineage for d4pzkb_ (4pzk B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (16 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [257590] (1 PDB entry)

8. Domain d4pzkb_: 4pzk B: [257592]
   automated match to d3l8ub_
   complexed with sah

Details for d4pzkb_

PDB Entry: 4pzk, 1.5 Å

PDB Description: Crystal strucrure of putative RNA methyltransferase from Bacillus anthracis.

PDB Compounds: (B:) tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d4pzkb_:

Sequence; same for both SEQRES and ATOM records:

>d4pzkb_ c.116.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
gvhvvlyqpeipantgniartcaatgtelhlirplgfstddkmlkragldywqhvkityy
dsieefyeknkdgeffyltkygekahtafdyskrekdyyfvfgretnglpanvieenfdh
clripmtdkvrslnlsntaailiyeafrqqnypgldlei

Timeline for d4pzkb_:

• d4pzkb_ first appeared in SCOPe 2.04
  
• d4pzkb_ appears in SCOPe 2.06