![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
![]() | Superfamily c.116.1: alpha/beta knot [75217] (9 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
![]() | Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
![]() | Protein automated matches [190961] (22 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:261594] [257590] (1 PDB entry) |
![]() | Domain d4pzkb_: 4pzk B: [257592] automated match to d3l8ub_ complexed with sah |
PDB Entry: 4pzk (more details), 1.5 Å
SCOPe Domain Sequences for d4pzkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzkb_ c.116.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]} gvhvvlyqpeipantgniartcaatgtelhlirplgfstddkmlkragldywqhvkityy dsieefyeknkdgeffyltkygekahtafdyskrekdyyfvfgretnglpanvieenfdh clripmtdkvrslnlsntaailiyeafrqqnypgldlei
Timeline for d4pzkb_: