Lineage for d4pzkb_ (4pzk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921420Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 2921421Protein automated matches [190961] (22 species)
    not a true protein
  7. 2921437Species Bacillus anthracis [TaxId:261594] [257590] (1 PDB entry)
  8. 2921439Domain d4pzkb_: 4pzk B: [257592]
    automated match to d3l8ub_
    complexed with sah

Details for d4pzkb_

PDB Entry: 4pzk (more details), 1.5 Å

PDB Description: Crystal strucrure of putative RNA methyltransferase from Bacillus anthracis.
PDB Compounds: (B:) tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d4pzkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pzkb_ c.116.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
gvhvvlyqpeipantgniartcaatgtelhlirplgfstddkmlkragldywqhvkityy
dsieefyeknkdgeffyltkygekahtafdyskrekdyyfvfgretnglpanvieenfdh
clripmtdkvrslnlsntaailiyeafrqqnypgldlei

SCOPe Domain Coordinates for d4pzkb_:

Click to download the PDB-style file with coordinates for d4pzkb_.
(The format of our PDB-style files is described here.)

Timeline for d4pzkb_: